SCOPe 2.06: Domain d5uu7a_: 5uu7 A:

Lineage for d5uu7a_ (5uu7 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
   includes alpha-helical C-terminal domain characteristic for the family

6. Protein Thermolysin [63414] (3 species)

7. Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (172 PDB entries)
   Uniprot P00800

8. Domain d5uu7a_: 5uu7 A: [330914]
   automated match to d1kkka_
   complexed with ca, cl, dms, mpd, mrd, zn

Details for d5uu7a_

PDB Entry: 5uu7, 1.6 Å

PDB Description: tetragonal thermolysin (295 k) in the presence of 50% mpd

PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d5uu7a_:

Sequence; same for both SEQRES and ATOM records:

>d5uu7a_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

Timeline for d5uu7a_:

• d5uu7a_ is new in SCOPe 2.06-stable
  
• d5uu7a_ appears in SCOPe 2.07
  
• d5uu7a_ appears in the current release, SCOPe 2.08