SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uvea1 (5uve A:26-304)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2284848Species Brucella abortus [TaxId:359391] [328149] (2 PDB entries)
  8. 2287611Domain d5uvea1: 5uve A:26-304 [330912]
    Other proteins in same PDB: d5uvea2, d5uveb2, d5uvec2, d5uved2, d5uvee2, d5uvef2, d5uveg2, d5uveh2
    automated match to d4ne4a_
    complexed with ca, gol

Details for d5uvea1

PDB Entry: 5uve (more details), 2.5 Å

PDB Description: crystal structure of the abc transporter substrate-binding protein bab1_0226 from brucella abortus
PDB Compounds: (A:) Substrate-binding region of ABC-type glycine betaine transport system

SCOPe Domain Sequences for d5uvea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uvea1 c.94.1.0 (A:26-304) automated matches {Brucella abortus [TaxId: 359391]}
vavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytgna
afffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenklas
lsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatiaaa
anqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieellkp
vfekldlttlqdlngrvqlggepakavaedflkkngflk

SCOPe Domain Coordinates for d5uvea1:

Click to download the PDB-style file with coordinates for d5uvea1.
(The format of our PDB-style files is described here.)

Timeline for d5uvea1:

  • d5uvea1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09