SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uuba_ (5uub A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2183653Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2183667Family d.92.1.2: Thermolysin-like [55490] (5 protein domains)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2183681Protein Thermolysin [63414] (3 species)
  7. 2183682Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (149 PDB entries)
    Uniprot P00800
  8. 2287594Domain d5uuba_: 5uub A: [330895]
    automated match to d1kkka_
    complexed with ca, cl, mpd, mrd, xyp, zn

Details for d5uuba_

PDB Entry: 5uub (more details), 1.6 Å

PDB Description: tetragonal thermolysin cryocooled to 100 k with 25% xylose/25% mpd as cryoprotectant
PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d5uuba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uuba_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d5uuba_:

Click to download the PDB-style file with coordinates for d5uuba_.
(The format of our PDB-style files is described here.)

Timeline for d5uuba_:

  • d5uuba_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09