Lineage for d5uved1 (5uve D:26-303)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2284848Species Brucella abortus [TaxId:359391] [328149] (2 PDB entries)
  8. 2287589Domain d5uved1: 5uve D:26-303 [330890]
    Other proteins in same PDB: d5uvea2, d5uveb2, d5uvec2, d5uved2, d5uvee2, d5uvef2, d5uveg2, d5uveh2
    automated match to d4ne4a_
    complexed with ca, gol

Details for d5uved1

PDB Entry: 5uve (more details), 2.5 Å

PDB Description: crystal structure of the abc transporter substrate-binding protein bab1_0226 from brucella abortus
PDB Compounds: (D:) Substrate-binding region of ABC-type glycine betaine transport system

SCOPe Domain Sequences for d5uved1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uved1 c.94.1.0 (D:26-303) automated matches {Brucella abortus [TaxId: 359391]}
vavsskidteggvlgniiltvlnangikttdriqlgatpvvrkaitageidiypeytgna
afffnkaddplwkdpakayetakkldydankivwltpspanntwgiavrkdvanenklas
lsdfgkyiagggkvvlaassefvnsaaalpafqtaygftlkpdqlitlsggdtaatiaaa
anqtnganaamvygtdggiapsglvvleddkhvqpvyqpapiireevlkkdpkieellkp
vfekldlttlqdlngrvqlggepakavaedflkkngfl

SCOPe Domain Coordinates for d5uved1:

Click to download the PDB-style file with coordinates for d5uved1.
(The format of our PDB-style files is described here.)

Timeline for d5uved1:

  • d5uved1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09