SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t4zb1 (5t4z B:3-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2029353Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (12 PDB entries)
  8. 2287587Domain d5t4zb1: 5t4z B:3-107 [330888]
    Other proteins in same PDB: d5t4zb2, d5t4zl2
    automated match to d1aqkl1
    complexed with ca, man

Details for d5t4zb1

PDB Entry: 5t4z (more details), 1.99 Å

PDB Description: structure of the anti-hiv antibody dh501 that binds gp120 v3 glycan and the base of v3 with free man9 glycan
PDB Compounds: (B:) antibody DH501 L chain

SCOPe Domain Sequences for d5t4zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4zb1 b.1.1.0 (B:3-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
vltqppsvsgapgqrvtiscagtksnigdcsvswyqqlpgatprlliyqnnnrpsgvsdr
fsgsksgtsaslaitglqtedeadyfclsydtsfsgwrfgggtrltvlg

SCOPe Domain Coordinates for d5t4zb1:

Click to download the PDB-style file with coordinates for d5t4zb1.
(The format of our PDB-style files is described here.)

Timeline for d5t4zb1:

  • d5t4zb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5t4zb2