SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uixl2 (5uix L:107-213)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (610 PDB entries)
  8. 2287577Domain d5uixl2: 5uix L:107-213 [330878]
    Other proteins in same PDB: d5uixl1
    automated match to d1dn0a2

Details for d5uixl2

PDB Entry: 5uix (more details), 2.5 Å

PDB Description: crystal structure of the dh576 cd4bs fab (unliganded) from the rv305 hiv vaccine trial
PDB Compounds: (L:) DH576 Fab light chain

SCOPe Domain Sequences for d5uixl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uixl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5uixl2:

Click to download the PDB-style file with coordinates for d5uixl2.
(The format of our PDB-style files is described here.)

Timeline for d5uixl2:

  • d5uixl2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09