SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jp7a1 (5jp7 A:2-126)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987554Family a.24.3.2: Cytochrome c'-like [47179] (3 protein domains)
    automatically mapped to Pfam PF01322
  6. 1987599Protein automated matches [190363] (5 species)
    not a true protein
  7. 2287374Species Alcaligenes xylosoxydans [TaxId:85698] [330675] (7 PDB entries)
  8. 2287553Domain d5jp7a1: 5jp7 A:2-126 [330854]
    Other proteins in same PDB: d5jp7a2
    automated match to d4cdaa_
    complexed with hec; mutant

Details for d5jp7a1

PDB Entry: 5jp7 (more details), 1.26 Å

PDB Description: ferrous leu 16 val mutant of cytochrome c prime from alcaligenes xylosoxidans
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d5jp7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jp7a1 a.24.3.2 (A:2-126) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
fakpedavkyrqsavtlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafgp
gteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckachd
ayrkk

SCOPe Domain Coordinates for d5jp7a1:

Click to download the PDB-style file with coordinates for d5jp7a1.
(The format of our PDB-style files is described here.)

Timeline for d5jp7a1:

  • d5jp7a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5jp7a2