Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
Family c.1.5.0: automated matches [227276] (1 protein) not a true family |
Protein automated matches [227084] (14 species) not a true protein |
Species Clostridium perfringens [TaxId:195103] [258287] (9 PDB entries) |
Domain d5uxec_: 5uxe C: [330850] Other proteins in same PDB: d5uxeb2 automated match to d4q33a_ complexed with 8la, fmt, imp, k, mpd, so4 |
PDB Entry: 5uxe (more details), 2.1 Å
SCOPe Domain Sequences for d5uxec_:
Sequence, based on SEQRES records: (download)
>d5uxec_ c.1.5.0 (C:) automated matches {Clostridium perfringens [TaxId: 195103]} arilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiam areggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivl dtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsictt rivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagc eeapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykghlad tiyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnysv
>d5uxec_ c.1.5.0 (C:) automated matches {Clostridium perfringens [TaxId: 195103]} arilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiam areggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivl dtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsictt rivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagc eeapgaieiyqgrsykvyrgmgslgamafvpegvegriaykghladtiyqliggiksgmg ylgaptlenlyenanfvvqtsagfreshphdinitkeapnysv
Timeline for d5uxec_:
View in 3D Domains from other chains: (mouse over for more information) d5uxea_, d5uxeb1, d5uxeb2, d5uxed_ |