Lineage for d5u4oa_ (5u4o A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2287546Species Bacillus anthracis [TaxId:1392] [330847] (1 PDB entry)
  8. 2287547Domain d5u4oa_: 5u4o A: [330848]
    automated match to d1uqwa_

Details for d5u4oa_

PDB Entry: 5u4o (more details), 2.05 Å

PDB Description: a 2.05a x-ray structureof a bacterial extracellular solute-binding protein, family 5 for bacillus anthracis str. ames
PDB Compounds: (A:) ABC transporter substrate-binding protein

SCOPe Domain Sequences for d5u4oa_:

Sequence, based on SEQRES records: (download)

>d5u4oa_ c.94.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 1392]}
eggvltiarlsdadnldphfitnipsasvvyhkvyenlvqrdknmdfkpmlakewkqidd
lnwefklqqgvtfqdgapfnaeavkknfervldpkvgsnratvysmiqeikvideytvqf
ilkypyspllsifasnegsilspkaidekgkglaqhpvgtgpytfkswkpgeeirleknk
nywgekakvdevvfkvvpedatrigmietseahiaenlpvtevervknspsmelienegl
gveyigfnvekkpfdnplvrqaiahaietkgilkgvynnvgteinsvmtpkvfgytkdvk
gykydintakklladagypngfkttiwtndskvrmalveviqsqlkgigvdveikvmeyg
aflaatnksehamfvggwgnatgdgdynqynlfhssshgatgnqffysnpevdklieear
kekdetkrkelykqlqeielkdallvpirginhiaattknikgfwidpsgylrlegvelq

Sequence, based on observed residues (ATOM records): (download)

>d5u4oa_ c.94.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 1392]}
eggvltiarlsdadnldphfitnipsasvvyhkvyenlvqrdknmdfkpmlakewkqidd
lnwefklqqgvtfqdgapfnaeavkknfervldpktvysmiqeikvideytvqfilkypy
spllsifasnegsilspkaidekgkglaqhpvgtgpytfkswkpgeeirleknknywgek
akvdevvfkvvpedatrigmietseahiaenlpvtevervknspsmelieneglgveyig
fnvekkpfdnplvrqaiahaietkgilkgvynnvgteinsvmtpkvfgytkdvkgykydi
ntakklladagypngfkttiwtndskvrmalveviqsqlkgigvdveikvmeygaflaat
nksehamfvggwgnatgdgdynqynlfhssshgatgnqffysnpevdklieearkekdet
krkelykqlqeielkdallvpirginhiaattknikgfwidpsgylrlegvelq

SCOPe Domain Coordinates for d5u4oa_:

Click to download the PDB-style file with coordinates for d5u4oa_.
(The format of our PDB-style files is described here.)

Timeline for d5u4oa_:

  • d5u4oa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09