SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5urna1 (5urn A:2-115)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062091Family b.55.1.9: TFIIH domain [110272] (2 protein domains)
  6. 2062092Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (2 species)
  7. 2062093Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (10 PDB entries)
    Uniprot P32776 2-115
  8. 2287542Domain d5urna1: 5urn A:2-115 [330843]
    Other proteins in same PDB: d5urna2
    automated match to d2gs0a_

Details for d5urna1

PDB Entry: 5urn (more details)

PDB Description: nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the transactivation domain 1 of p65
PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOPe Domain Sequences for d5urna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5urna1 b.55.1.9 (A:2-115) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmmlr
ligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

SCOPe Domain Coordinates for d5urna1:

Click to download the PDB-style file with coordinates for d5urna1.
(The format of our PDB-style files is described here.)

Timeline for d5urna1:

  • d5urna1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09