Lineage for d5urna1 (5urn A:2-115)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062091Family b.55.1.9: TFIIH domain [110272] (2 protein domains)
  6. 2062092Protein RNA polymerase II transcription factor B 73 kDa, TFB1 [141434] (2 species)
  7. 2062093Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141435] (10 PDB entries)
    Uniprot P32776 2-115
  8. 2287542Domain d5urna1: 5urn A:2-115 [330843]
    Other proteins in same PDB: d5urna2
    automated match to d2gs0a_

Details for d5urna1

PDB Entry: 5urn (more details)

PDB Description: nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the transactivation domain 1 of p65
PDB Compounds: (A:) RNA polymerase II transcription factor B subunit 1

SCOPe Domain Sequences for d5urna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5urna1 b.55.1.9 (A:2-115) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmmlr
ligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

SCOPe Domain Coordinates for d5urna1:

Click to download the PDB-style file with coordinates for d5urna1.
(The format of our PDB-style files is described here.)

Timeline for d5urna1:

  • d5urna1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09