SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jrgc_ (5jrg C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986958Protein automated matches [193445] (6 species)
    not a true protein
  7. 1986983Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (15 PDB entries)
  8. 2287539Domain d5jrgc_: 5jrg C: [330840]
    Other proteins in same PDB: d5jrgb_, d5jrgf_
    automated match to d2pyoc_
    protein/DNA complex; complexed with cl, mn

Details for d5jrgc_

PDB Entry: 5jrg (more details), 2.5 Å

PDB Description: crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
PDB Compounds: (C:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d5jrgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrgc_ a.22.1.1 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
akaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaar
dnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d5jrgc_:

Click to download the PDB-style file with coordinates for d5jrgc_.
(The format of our PDB-style files is described here.)

Timeline for d5jrgc_:

  • d5jrgc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09