SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jlia_ (5jli A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987554Family a.24.3.2: Cytochrome c'-like [47179] (3 protein domains)
    automatically mapped to Pfam PF01322
  6. 1987599Protein automated matches [190363] (5 species)
    not a true protein
  7. 1987600Species Achromobacter xylosoxidans [TaxId:85698] [189489] (28 PDB entries)
  8. 2287514Domain d5jlia_: 5jli A: [330815]
    automated match to d2yl0a_
    complexed with asc, hec, no, so4; mutant

Details for d5jlia_

PDB Entry: 5jli (more details), 1.55 Å

PDB Description: nitric oxide complex of the l16a mutant of cytochrome c prime from alcaligenes xylosoxidans
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d5jlia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jlia_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsaatlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkkk

SCOPe Domain Coordinates for d5jlia_:

Click to download the PDB-style file with coordinates for d5jlia_.
(The format of our PDB-style files is described here.)

Timeline for d5jlia_:

  • d5jlia_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09