Lineage for d5jlia_ (5jli A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987554Family a.24.3.2: Cytochrome c'-like [47179] (3 protein domains)
    automatically mapped to Pfam PF01322
  6. 1987599Protein automated matches [190363] (5 species)
    not a true protein
  7. 1987600Species Achromobacter xylosoxidans [TaxId:85698] [189489] (28 PDB entries)
  8. 2287514Domain d5jlia_: 5jli A: [330815]
    automated match to d2yl0a_
    complexed with asc, hec, no, so4; mutant

Details for d5jlia_

PDB Entry: 5jli (more details), 1.55 Å

PDB Description: nitric oxide complex of the l16a mutant of cytochrome c prime from alcaligenes xylosoxidans
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d5jlia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jlia_ a.24.3.2 (A:) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
efakpedavkyrqsaatlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkkk

SCOPe Domain Coordinates for d5jlia_:

Click to download the PDB-style file with coordinates for d5jlia_.
(The format of our PDB-style files is described here.)

Timeline for d5jlia_:

  • d5jlia_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09