Lineage for d5svwc_ (5svw C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (20 species)
    not a true protein
  7. 2189253Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188508] (5 PDB entries)
  8. 2287511Domain d5svwc_: 5svw C: [330812]
    automated match to d4r38b_
    complexed with fmn

Details for d5svwc_

PDB Entry: 5svw (more details), 2.29 Å

PDB Description: light-state structure of arabidopsis thaliana zeitlupe
PDB Compounds: (C:) Adagio protein 1

SCOPe Domain Sequences for d5svwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5svwc_ d.110.3.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pcgfivtdavepdqpiiyvntvfemvtgyraeevlgrncrflqcrgpfakrrhplvdsmv
vseirkcidegiefqgellnfrkdgsplmnrlrltpiygdddtithiigiqffietdi

SCOPe Domain Coordinates for d5svwc_:

Click to download the PDB-style file with coordinates for d5svwc_.
(The format of our PDB-style files is described here.)

Timeline for d5svwc_:

  • d5svwc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09