Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (20 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188508] (5 PDB entries) |
Domain d5svud_: 5svu D: [330811] automated match to d4r38b_ complexed with fmn |
PDB Entry: 5svu (more details), 2.6 Å
SCOPe Domain Sequences for d5svud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5svud_ d.110.3.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pcgfvvtdavepdqpiiyvntvfemvtgyraeevlgrncrflqcrgpfakrrhplvdsmv vseirkcidegiefqgellnfrkdgsplmnrlrltpiygdddtithiigiqffietdidl
Timeline for d5svud_: