SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lwoa_ (5lwo A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2153717Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2153723Protein Phage T4 lysozyme [53982] (1 species)
  7. 2153724Species Bacteriophage T4 [TaxId:10665] [53983] (564 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2287508Domain d5lwoa_: 5lwo A: [330809]
    automated match to d3l2xa_
    complexed with bme, cl, hed, k, po4, rxr; mutant

Details for d5lwoa_

PDB Entry: 5lwo (more details), 1.18 Å

PDB Description: structure of spin-labelled t4 lysozyme mutant l115c-r119c-r1 at 100k
PDB Compounds: (A:) endolysin

SCOPe Domain Sequences for d5lwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lwoa_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslcm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d5lwoa_:

Click to download the PDB-style file with coordinates for d5lwoa_.
(The format of our PDB-style files is described here.)

Timeline for d5lwoa_:

  • d5lwoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09