Lineage for d5ursb1 (5urs B:1-486)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415584Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2415631Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2415632Protein automated matches [227084] (14 species)
    not a true protein
  7. 2415633Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [330485] (5 PDB entries)
  8. 2415643Domain d5ursb1: 5urs B:1-486 [330805]
    Other proteins in same PDB: d5ursa2, d5ursb2, d5ursc2, d5ursd2, d5urse2, d5ursf2, d5ursg2, d5ursh2
    automated match to d4q33e_
    complexed with 8la, edo, gol, imp, k, peg, po4

Details for d5ursb1

PDB Entry: 5urs (more details), 2.39 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from bacillus anthracis in the complex with imp and the inhibitor p178
PDB Compounds: (B:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5ursb1:

Sequence, based on SEQRES records: (download)

>d5ursb1 c.1.5.0 (B:1-486) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqegnkklvpegiegrvpykgp
ladtvhqlvgglragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys

Sequence, based on observed residues (ATOM records): (download)

>d5ursb1 c.1.5.0 (B:1-486) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgamekklvpegiegrvpykgpladtvhqlvggl
ragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys

SCOPe Domain Coordinates for d5ursb1:

Click to download the PDB-style file with coordinates for d5ursb1.
(The format of our PDB-style files is described here.)

Timeline for d5ursb1: