Lineage for d5touj_ (5tou J:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979193Protein automated matches [190531] (18 species)
    not a true protein
  7. 1979404Species Pseudanabaena sp. [TaxId:1357935] [330784] (1 PDB entry)
  8. 1979414Domain d5touj_: 5tou J: [330803]
    automated match to d1cpcb_
    complexed with cyc

Details for d5touj_

PDB Entry: 5tou (more details), 2.04 Å

PDB Description: structure of c-phycocyanin from arctic pseudanabaena sp. lw0831
PDB Compounds: (J:) Phycocyanin beta-1 subunit

SCOPe Domain Sequences for d5touj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5touj_ a.1.1.3 (J:) automated matches {Pseudanabaena sp. [TaxId: 1357935]}
mydafakvvsqadsrgayisasqidalsamvadgskrldavnritsnssaivanaaralf
aeqpaliapggnaytsrrmaaclrdmeivlryvtyaiysgdasiledrclnglketylal
gtpgssvavgigkmkdaaiaiandpngvtrgdcsalmseigsyfdkaaaava

SCOPe Domain Coordinates for d5touj_:

Click to download the PDB-style file with coordinates for d5touj_.
(The format of our PDB-style files is described here.)

Timeline for d5touj_: