Class a: All alpha proteins [46456] (289 folds) |
Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily) 3 helices; bundle, partly opened |
Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) automatically mapped to Pfam PF02172 |
Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein) |
Protein Kix domain of CBP (creb binding protein) [47042] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47043] (10 PDB entries) |
Domain d5u4ka_: 5u4k A: [330802] automated match to d2lxsa_ |
PDB Entry: 5u4k (more details)
SCOPe Domain Sequences for d5u4ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u4ka_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]} gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans rdeyyhllaekiykiqkeleekrrsrl
Timeline for d5u4ka_: