SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u4ka_ (5u4k A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986157Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 1986158Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 1986159Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 1986160Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 1986161Species Mouse (Mus musculus) [TaxId:10090] [47043] (10 PDB entries)
  8. 2287501Domain d5u4ka_: 5u4k A: [330802]
    automated match to d2lxsa_

Details for d5u4ka_

PDB Entry: 5u4k (more details)

PDB Description: nmr structure of the complex between the kix domain of cbp and the transactivation domain 1 of p65
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5u4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u4ka_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkeleekrrsrl

SCOPe Domain Coordinates for d5u4ka_:

Click to download the PDB-style file with coordinates for d5u4ka_.
(The format of our PDB-style files is described here.)

Timeline for d5u4ka_:

  • d5u4ka_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09