SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5touk_ (5tou K:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1978832Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 protein domains)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979007Protein automated matches [190531] (18 species)
    not a true protein
  7. 2287483Species Pseudanabaena sp. [TaxId:1357935] [330784] (1 PDB entry)
  8. 2287497Domain d5touk_: 5tou K: [330798]
    automated match to d1cpca_
    complexed with cyc

Details for d5touk_

PDB Entry: 5tou (more details), 2.04 Å

PDB Description: structure of c-phycocyanin from arctic pseudanabaena sp. lw0831
PDB Compounds: (K:) Phycocyanin alpha-1 subunit

SCOPe Domain Sequences for d5touk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5touk_ a.1.1.3 (K:) automated matches {Pseudanabaena sp. [TaxId: 1357935]}
mktplteavsaadsqgrflsttetqvafgrfrqatsglaaakalsekaeslasgaanavy
skfpyttsmtganyassqtgkdkcvrdigyyirmvtyccvvggtgpmddylvagiaeinr
tfdlspswyvealkyvkanhglsgdsaveansyidyainals

SCOPe Domain Coordinates for d5touk_:

Click to download the PDB-style file with coordinates for d5touk_.
(The format of our PDB-style files is described here.)

Timeline for d5touk_:

  • d5touk_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09