SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5im1a2 (5im1 A:221-548)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010765Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 protein domains)
    automatically mapped to Pfam PF03936
  6. 2010790Protein automated matches [227033] (1 species)
    not a true protein
  7. 2010791Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225866] (23 PDB entries)
  8. 2287494Domain d5im1a2: 5im1 A:221-548 [330795]
    Other proteins in same PDB: d5im1a1
    automated match to d3m00a2

Details for d5im1a2

PDB Entry: 5im1 (more details), 1.88 Å

PDB Description: tobacco 5-epi-aristolochene synthase without buffer molecule in the active site
PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d5im1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5im1a2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwalgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala
tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty
ihnldgythpekvlkphiinllvdsiki

SCOPe Domain Coordinates for d5im1a2:

Click to download the PDB-style file with coordinates for d5im1a2.
(The format of our PDB-style files is described here.)

Timeline for d5im1a2:

  • d5im1a2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5im1a1