Lineage for d5kaaa_ (5kaa A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116650Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2116651Protein automated matches [190475] (8 species)
    not a true protein
  7. 2116663Species Human (Homo sapiens) [TaxId:9606] [187400] (111 PDB entries)
  8. 2287489Domain d5kaaa_: 5kaa A: [330790]
    automated match to d2i1yb_
    complexed with cl, gol, trs; mutant

Details for d5kaaa_

PDB Entry: 5kaa (more details), 1.97 Å

PDB Description: protein tyrosine phosphatase 1b delta helix 7, p185g mutant, open state
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d5kaaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaaa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvgespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfi

SCOPe Domain Coordinates for d5kaaa_:

Click to download the PDB-style file with coordinates for d5kaaa_.
(The format of our PDB-style files is described here.)

Timeline for d5kaaa_:

  • d5kaaa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09