Lineage for d5jrgg_ (5jrg G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986958Protein automated matches [193445] (6 species)
    not a true protein
  7. 1986983Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (17 PDB entries)
  8. 2287481Domain d5jrgg_: 5jrg G: [330782]
    Other proteins in same PDB: d5jrgb_, d5jrgf_
    automated match to d2pyoc_
    protein/DNA complex; complexed with cl, mn

Details for d5jrgg_

PDB Entry: 5jrg (more details), 2.5 Å

PDB Description: crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
PDB Compounds: (G:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d5jrgg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrgg_ a.22.1.1 (G:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
arakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagna
ardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d5jrgg_:

Click to download the PDB-style file with coordinates for d5jrgg_.
(The format of our PDB-style files is described here.)

Timeline for d5jrgg_:

  • d5jrgg_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09