Lineage for d5ifhh1 (5ifh H:2-116)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (28 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2287480Domain d5ifhh1: 5ifh H:2-116 [330781]
    Other proteins in same PDB: d5ifhl2
    automated match to d1dn0b1

Details for d5ifhh1

PDB Entry: 5ifh (more details), 2.29 Å

PDB Description: crystal structure of the bcr fab fragment from subset #2 case p11475
PDB Compounds: (H:) Heavy chain of the Fab fragment from BCR derived from the P11475 CLL clone

SCOPe Domain Sequences for d5ifhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ifhh1 b.1.1.0 (H:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvkpggslrlscaasgftfrsysmnwvrqapgkglewvssiissssyiyya
dsvkgrftisrdnaknslylqmnslraedtalyycardqnamdvwgqgttvtvss

SCOPe Domain Coordinates for d5ifhh1:

Click to download the PDB-style file with coordinates for d5ifhh1.
(The format of our PDB-style files is described here.)

Timeline for d5ifhh1:

  • d5ifhh1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09