Lineage for d5svwd_ (5svw D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2534777Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2535027Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2535028Protein automated matches [190492] (20 species)
    not a true protein
  7. 2535139Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188508] (5 PDB entries)
  8. 2535149Domain d5svwd_: 5svw D: [330779]
    automated match to d4r38b_
    complexed with fmn

Details for d5svwd_

PDB Entry: 5svw (more details), 2.29 Å

PDB Description: light-state structure of arabidopsis thaliana zeitlupe
PDB Compounds: (D:) Adagio protein 1

SCOPe Domain Sequences for d5svwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5svwd_ d.110.3.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pcgfivtdavepdqpiiyvntvfemvtgyraeevlgrncrflqcrgpfakrrhplvdsmv
vseirkcidegiefqgellnfrkdgsplmnrlrltpiygdddtithiigiqffietdidl
gp

SCOPe Domain Coordinates for d5svwd_:

Click to download the PDB-style file with coordinates for d5svwd_.
(The format of our PDB-style files is described here.)

Timeline for d5svwd_: