SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5svwd_ (5svw D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (19 species)
    not a true protein
  7. 2189253Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188508] (5 PDB entries)
  8. 2287478Domain d5svwd_: 5svw D: [330779]
    automated match to d4r38b_
    complexed with fmn

Details for d5svwd_

PDB Entry: 5svw (more details), 2.29 Å

PDB Description: light-state structure of arabidopsis thaliana zeitlupe
PDB Compounds: (D:) Adagio protein 1

SCOPe Domain Sequences for d5svwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5svwd_ d.110.3.0 (D:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pcgfivtdavepdqpiiyvntvfemvtgyraeevlgrncrflqcrgpfakrrhplvdsmv
vseirkcidegiefqgellnfrkdgsplmnrlrltpiygdddtithiigiqffietdidl
gp

SCOPe Domain Coordinates for d5svwd_:

Click to download the PDB-style file with coordinates for d5svwd_.
(The format of our PDB-style files is described here.)

Timeline for d5svwd_:

  • d5svwd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09