SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l2na_ (5l2n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140987Protein automated matches [190401] (5 species)
    not a true protein
  7. 2140988Species Human (Homo sapiens) [TaxId:9606] [189906] (17 PDB entries)
  8. 2287477Domain d5l2na_: 5l2n A: [330778]
    automated match to d5ac2a_
    complexed with 6zu, cl, yb

Details for d5l2na_

PDB Entry: 5l2n (more details), 1.7 Å

PDB Description: structure of aldh1a1 in complex with buc25
PDB Compounds: (A:) Retinal dehydrogenase 1

SCOPe Domain Sequences for d5l2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l2na_ c.82.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlpvlltdlkiqytkifinnewhdsvsgkkfpvfnpateeelcqveegdkedvdkavkaa
rqafqigspwrtmdasergrllykladlierdrlllatmesmnggklysnaylndlagci
ktlrycagwadkiqgrtipidgnfftytrhepigvcgqiipwnfplvmliwkigpalscg
ntvvvkpaeqtpltalhvaslikeagfppgvvnivpgygptagaaisshmdidkvaftgs
tevgklikeaagksnlkrvtlelggkspcivladadldnavefahhgvfyhqgqcciaas
rifveesiydefvrrsverakkyilgnpltpgvtqgpqidkeqydkildliesgkkegak
lecgggpwgnkgyfvqptvfsnvtdemriakeeifgpvqqimkfkslddvikranntfyg
lsagvftkdidkaitissalqagtvwvncygvvsaqcpfggfkmsgngrelgeygfheyt
evktvtvkisqkns

SCOPe Domain Coordinates for d5l2na_:

Click to download the PDB-style file with coordinates for d5l2na_.
(The format of our PDB-style files is described here.)

Timeline for d5l2na_:

  • d5l2na_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09