SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5svuc_ (5svu C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188697Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2188938Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2189175Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2189176Protein automated matches [190492] (19 species)
    not a true protein
  7. 2189253Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188508] (5 PDB entries)
  8. 2287471Domain d5svuc_: 5svu C: [330772]
    automated match to d4r38b_
    complexed with fmn

Details for d5svuc_

PDB Entry: 5svu (more details), 2.6 Å

PDB Description: structure and kinetics of the lov domain of zeitlupe determine its circadian function in arabidopsis
PDB Compounds: (C:) Adagio protein 1

SCOPe Domain Sequences for d5svuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5svuc_ d.110.3.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pcgfvvtdavepdqpiiyvntvfemvtgyraeevlgrncrflqcrgpfakrrhplvdsmv
vseirkcidegiefqgellnfrkdgsplmnrlrltpiygdddtithiigiqffietdidl
gp

SCOPe Domain Coordinates for d5svuc_:

Click to download the PDB-style file with coordinates for d5svuc_.
(The format of our PDB-style files is described here.)

Timeline for d5svuc_:

  • d5svuc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09