SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j5hj1 (5j5h J:1-206)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073887Protein automated matches [190922] (2 species)
    not a true protein
  7. 2073888Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (30 PDB entries)
  8. 2287467Domain d5j5hj1: 5j5h J:1-206 [330768]
    Other proteins in same PDB: d5j5ha2, d5j5hb2, d5j5hc2, d5j5hd2, d5j5he2, d5j5hh2, d5j5hi2, d5j5hj2
    automated match to d3u8kd_
    complexed with 6gk, nag, po4

Details for d5j5hj1

PDB Entry: 5j5h (more details), 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with 6-(2-methoxyphenyl)-n4,n4-bis[(pyridin-2-yl)methyl]pyrimidine-2, 4-diamine
PDB Compounds: (J:) acetylcholine-binding protein

SCOPe Domain Sequences for d5j5hj1:

Sequence, based on SEQRES records: (download)

>d5j5hj1 b.96.1.1 (J:1-206) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkgr

Sequence, based on observed residues (ATOM records): (download)

>d5j5hj1 b.96.1.1 (J:1-206) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptsddseyfsqysrfeildvtqkknsv
tysccpeayedvevslnfrkkgr

SCOPe Domain Coordinates for d5j5hj1:

Click to download the PDB-style file with coordinates for d5j5hj1.
(The format of our PDB-style files is described here.)

Timeline for d5j5hj1:

  • d5j5hj1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09