Lineage for d5t35h_ (5t35 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768904Domain d5t35h_: 5t35 H: [330767]
    Other proteins in same PDB: d5t35a_, d5t35b_, d5t35c1, d5t35c2, d5t35e_, d5t35f_, d5t35g1, d5t35g2
    automated match to d1lqbc_
    complexed with 759

Details for d5t35h_

PDB Entry: 5t35 (more details), 2.7 Å

PDB Description: the protac mz1 in complex with the second bromodomain of brd4 and pvhl:elonginc:elonginb
PDB Compounds: (H:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5t35h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t35h_ b.3.3.1 (H:) VHL {Human (Homo sapiens) [TaxId: 9606]}
pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
vrslyedledhpnvqkdlerltqeria

SCOPe Domain Coordinates for d5t35h_:

Click to download the PDB-style file with coordinates for d5t35h_.
(The format of our PDB-style files is described here.)

Timeline for d5t35h_: