Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d5t35h_: 5t35 H: [330767] Other proteins in same PDB: d5t35a_, d5t35b_, d5t35c1, d5t35c2, d5t35e_, d5t35f_, d5t35g1, d5t35g2 automated match to d1lqbc_ complexed with 759 |
PDB Entry: 5t35 (more details), 2.7 Å
SCOPe Domain Sequences for d5t35h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t35h_ b.3.3.1 (H:) VHL {Human (Homo sapiens) [TaxId: 9606]} pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi vrslyedledhpnvqkdlerltqeria
Timeline for d5t35h_: