SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t35h_ (5t35 H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2034948Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2034949Family b.3.3.1: VHL [49469] (2 protein domains)
  6. 2034950Protein VHL [49470] (1 species)
  7. 2034951Species Human (Homo sapiens) [TaxId:9606] [49471] (19 PDB entries)
  8. 2287466Domain d5t35h_: 5t35 H: [330767]
    Other proteins in same PDB: d5t35a_, d5t35b_, d5t35c1, d5t35c2, d5t35e_, d5t35f_, d5t35g1, d5t35g2
    automated match to d1lqbc_
    complexed with 759

Details for d5t35h_

PDB Entry: 5t35 (more details), 2.7 Å

PDB Description: the protac mz1 in complex with the second bromodomain of brd4 and pvhl:elonginc:elonginb
PDB Compounds: (H:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5t35h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t35h_ b.3.3.1 (H:) VHL {Human (Homo sapiens) [TaxId: 9606]}
pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
vrslyedledhpnvqkdlerltqeria

SCOPe Domain Coordinates for d5t35h_:

Click to download the PDB-style file with coordinates for d5t35h_.
(The format of our PDB-style files is described here.)

Timeline for d5t35h_:

  • d5t35h_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09