Lineage for d5jrdm_ (5jrd M:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222059Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2222060Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2222201Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2222202Protein automated matches [191173] (9 species)
    not a true protein
  7. 2287365Species Escherichia coli [TaxId:83333] [330666] (3 PDB entries)
  8. 2287463Domain d5jrdm_: 5jrd M: [330764]
    Other proteins in same PDB: d5jrds_, d5jrdt_
    automated match to d5a4il_
    complexed with cl, f3s, fco, mg, ni, sf3, sf4, so4

Details for d5jrdm_

PDB Entry: 5jrd (more details), 1.2 Å

PDB Description: e. coli hydrogenase-1 variant p508a
PDB Compounds: (M:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d5jrdm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrdm_ e.18.1.0 (M:) automated matches {Escherichia coli [TaxId: 83333]}
stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteaargalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth

SCOPe Domain Coordinates for d5jrdm_:

Click to download the PDB-style file with coordinates for d5jrdm_.
(The format of our PDB-style files is described here.)

Timeline for d5jrdm_:

  • d5jrdm_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09