SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jrdm_ (5jrd M:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222059Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2222060Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2222201Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2222202Protein automated matches [191173] (8 species)
    not a true protein
  7. 2287365Species Escherichia coli [TaxId:83333] [330666] (1 PDB entry)
  8. 2287463Domain d5jrdm_: 5jrd M: [330764]
    Other proteins in same PDB: d5jrds_, d5jrdt_
    automated match to d5a4il_
    complexed with cl, f3s, fco, mg, ni, sf3, sf4, so4

Details for d5jrdm_

PDB Entry: 5jrd (more details), 1.2 Å

PDB Description: e. coli hydrogenase-1 variant p508a
PDB Compounds: (M:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d5jrdm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrdm_ e.18.1.0 (M:) automated matches {Escherichia coli [TaxId: 83333]}
stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteaargalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth

SCOPe Domain Coordinates for d5jrdm_:

Click to download the PDB-style file with coordinates for d5jrdm_.
(The format of our PDB-style files is described here.)

Timeline for d5jrdm_:

  • d5jrdm_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09