SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jrge_ (5jrg E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986958Protein automated matches [193445] (6 species)
    not a true protein
  7. 1986993Species Human (Homo sapiens) [TaxId:9606] [193446] (44 PDB entries)
  8. 2287462Domain d5jrge_: 5jrg E: [330763]
    Other proteins in same PDB: d5jrgb_, d5jrgf_
    automated match to d1eqzg_
    protein/DNA complex; complexed with cl, mn

Details for d5jrge_

PDB Entry: 5jrg (more details), 2.5 Å

PDB Description: crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
PDB Compounds: (E:) Histone H3.1

SCOPe Domain Sequences for d5jrge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrge_ a.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
eaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d5jrge_:

Click to download the PDB-style file with coordinates for d5jrge_.
(The format of our PDB-style files is described here.)

Timeline for d5jrge_:

  • d5jrge_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09