Lineage for d5ijma1 (5ijm A:1-96)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986009Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1986010Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 1986031Family a.11.1.0: automated matches [191596] (1 protein)
    not a true family
  6. 1986032Protein automated matches [191086] (6 species)
    not a true protein
  7. 2287456Species Leishmania major [TaxId:5664] [330757] (1 PDB entry)
  8. 2287457Domain d5ijma1: 5ijm A:1-96 [330758]
    Other proteins in same PDB: d5ijma2
    automated match to d2cb8a_

Details for d5ijma1

PDB Entry: 5ijm (more details), 1.46 Å

PDB Description: crystal structure of an acyl-coa binding protein (lmjf.17.0620) of leishmania major
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5ijma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ijma1 a.11.1.0 (A:1-96) automated matches {Leishmania major [TaxId: 5664]}
msaadfeaavayvrslpkegpvqldnaaklqfyslykqategdvtgsqpwavqvearakw
dawnsckgmksedakaayvrrlltllrsqgiqwkpg

SCOPe Domain Coordinates for d5ijma1:

Click to download the PDB-style file with coordinates for d5ijma1.
(The format of our PDB-style files is described here.)

Timeline for d5ijma1:

  • d5ijma1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5ijma2