SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ijma1 (5ijm A:1-96)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986009Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1986010Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 1986031Family a.11.1.0: automated matches [191596] (1 protein)
    not a true family
  6. 1986032Protein automated matches [191086] (5 species)
    not a true protein
  7. 2287456Species Leishmania major [TaxId:5664] [330757] (1 PDB entry)
  8. 2287457Domain d5ijma1: 5ijm A:1-96 [330758]
    Other proteins in same PDB: d5ijma2
    automated match to d2cb8a_

Details for d5ijma1

PDB Entry: 5ijm (more details), 1.46 Å

PDB Description: crystal structure of an acyl-coa binding protein (lmjf.17.0620) of leishmania major
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5ijma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ijma1 a.11.1.0 (A:1-96) automated matches {Leishmania major [TaxId: 5664]}
msaadfeaavayvrslpkegpvqldnaaklqfyslykqategdvtgsqpwavqvearakw
dawnsckgmksedakaayvrrlltllrsqgiqwkpg

SCOPe Domain Coordinates for d5ijma1:

Click to download the PDB-style file with coordinates for d5ijma1.
(The format of our PDB-style files is described here.)

Timeline for d5ijma1:

  • d5ijma1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5ijma2