SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h20a_ (5h20 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (66 species)
    not a true protein
  7. 2287454Species Bacteroides fragilis [TaxId:272559] [330755] (1 PDB entry)
  8. 2287455Domain d5h20a_: 5h20 A: [330756]
    automated match to d3f8fa_
    complexed with glc, ipa, po4

Details for d5h20a_

PDB Entry: 5h20 (more details), 2.5 Å

PDB Description: x-ray structure of padr-like transcription factor from bacteroid fragilis
PDB Compounds: (A:) Putative PadR-family transcriptional regulatory protein

SCOPe Domain Sequences for d5h20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h20a_ a.4.5.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]}
dnvksqmrkgmleycimlllhkepayasdiiqklkearlivvegtlyplltrlknddlls
yewvestqgpprkyykltgkgesflgeleaswkelnetvnhia

SCOPe Domain Coordinates for d5h20a_:

Click to download the PDB-style file with coordinates for d5h20a_.
(The format of our PDB-style files is described here.)

Timeline for d5h20a_:

  • d5h20a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08