SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iolj1 (5iol J:2-149)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2173864Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2174114Protein automated matches [190032] (16 species)
    not a true protein
  7. 2287358Species Schistosoma mansoni [TaxId:6183] [330659] (1 PDB entry)
  8. 2287452Domain d5iolj1: 5iol J:2-149 [330753]
    Other proteins in same PDB: d5iola2, d5iolb2, d5iolc2, d5iold2, d5iole2, d5iolf2, d5iolg2, d5iolh2, d5ioli2, d5iolj2, d5iolk2, d5ioll2
    automated match to d5bxib_

Details for d5iolj1

PDB Entry: 5iol (more details), 1.74 Å

PDB Description: crystal structure of nucleoside diphosphate kinase from schistosoma mansoni
PDB Compounds: (J:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5iolj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iolj1 d.58.6.1 (J:2-149) automated matches {Schistosoma mansoni [TaxId: 6183]}
ertfimvkpdgvqrglvgeviqrferrgyklvaikmmhaseqllqthyealkslsffpkl
vaymssgpvvpmvfegrkvvengrtmlgatkpeascpgsirgdycqdvgrnvvhgsdste
sanreinlwfspqelcqykqavdpwihe

SCOPe Domain Coordinates for d5iolj1:

Click to download the PDB-style file with coordinates for d5iolj1.
(The format of our PDB-style files is described here.)

Timeline for d5iolj1:

  • d5iolj1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-09