SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i96b_ (5i96 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138634Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 protein domains)
    the active site is between the two identical subunits
  6. 2138768Protein automated matches [190072] (19 species)
    not a true protein
  7. 2138837Species Human (Homo sapiens) [TaxId:9606] [189131] (7 PDB entries)
  8. 2287441Domain d5i96b_: 5i96 B: [330742]
    Other proteins in same PDB: d5i96a2
    automated match to d1lwda_
    complexed with 69q, act, ca, gol, na, ndp; mutant

Details for d5i96b_

PDB Entry: 5i96 (more details), 1.55 Å

PDB Description: crystal structure of human mitochondrial isocitrate dehydrogenase (idh2) r140q mutant homodimer in complex with ag-221 (enasidenib) inhibitor.
PDB Compounds: (B:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d5i96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i96b_ c.77.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtidsal
atqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprlvp
gwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmgmy
ntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdknk
iwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgkti
eaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlekvc
vetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldral

SCOPe Domain Coordinates for d5i96b_:

Click to download the PDB-style file with coordinates for d5i96b_.
(The format of our PDB-style files is described here.)

Timeline for d5i96b_:

  • d5i96b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08