SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jrgd_ (5jrg D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986958Protein automated matches [193445] (6 species)
    not a true protein
  7. 1986993Species Human (Homo sapiens) [TaxId:9606] [193446] (44 PDB entries)
  8. 2287440Domain d5jrgd_: 5jrg D: [330741]
    Other proteins in same PDB: d5jrgb_, d5jrgf_
    automated match to d1kx4d_
    protein/DNA complex; complexed with cl, mn

Details for d5jrgd_

PDB Entry: 5jrg (more details), 2.5 Å

PDB Description: crystal structure of the nucleosome containing the dna with tetrahydrofuran (thf)
PDB Compounds: (D:) Histone H2B type 1-J

SCOPe Domain Sequences for d5jrgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrgd_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkrkrsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkr
stitsreiqtavrlllpgelakhavsegtkavtkyts

SCOPe Domain Coordinates for d5jrgd_:

Click to download the PDB-style file with coordinates for d5jrgd_.
(The format of our PDB-style files is described here.)

Timeline for d5jrgd_:

  • d5jrgd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08