SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l13e_ (5l13 E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140702Species Human (Homo sapiens), mitochondrial [TaxId:9606] [53726] (27 PDB entries)
    Uniprot P05091
  8. 2287438Domain d5l13e_: 5l13 E: [330739]
    automated match to d1bi9a_
    complexed with 6ze, edo, gai, na

Details for d5l13e_

PDB Entry: 5l13 (more details), 2.4 Å

PDB Description: structure of aldh2 in complex with 2p3
PDB Compounds: (E:) aldehyde dehydrogenase, mitochondrial

SCOPe Domain Sequences for d5l13e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l13e_ c.82.1.1 (E:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
qavpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavka
araafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmv
lkclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalat
gnvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftg
steigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccag
srtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqega
kllcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannsty
glaaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqay
tevktvtvkvpqkns

SCOPe Domain Coordinates for d5l13e_:

Click to download the PDB-style file with coordinates for d5l13e_.
(The format of our PDB-style files is described here.)

Timeline for d5l13e_:

  • d5l13e_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-09