Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein automated matches [190401] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189906] (18 PDB entries) |
Domain d5l2of_: 5l2o F: [330737] automated match to d5ac2a_ complexed with 6zw, cl, yb |
PDB Entry: 5l2o (more details), 2.05 Å
SCOPe Domain Sequences for d5l2of_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l2of_ c.82.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpvlltdlkiqytkifinnewhdsvsgkkfpvfnpateeelcqveegdkedvdkavkaar qafqigspwrtmdasergrllykladlierdrlllatmesmnggklysnaylndlagcik tlrycagwadkiqgrtipidgnfftytrhepigvcgqiipwnfplvmliwkigpalscgn tvvvkpaeqtpltalhvaslikeagfppgvvnivpgygptagaaisshmdidkvaftgst evgklikeaagksnlkrvtlelggkspcivladadldnavefahhgvfyhqgqcciaasr ifveesiydefvrrsverakkyilgnpltpgvtqgpqidkeqydkildliesgkkegakl ecgggpwgnkgyfvqptvfsnvtdemriakeeifgpvqqimkfkslddvikranntfygl sagvftkdidkaitissalqagtvwvncygvvsaqcpfggfkmsgngrelgeygfheyte vktvtvkisqkns
Timeline for d5l2of_: