SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ifhl2 (5ifh L:111-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (624 PDB entries)
  8. 2287427Domain d5ifhl2: 5ifh L:111-212 [330728]
    Other proteins in same PDB: d5ifhh1, d5ifhl1
    automated match to d1lila2

Details for d5ifhl2

PDB Entry: 5ifh (more details), 2.29 Å

PDB Description: crystal structure of the bcr fab fragment from subset #2 case p11475
PDB Compounds: (L:) Light chain of the Fab fragment from BCR derived from the P11475 CLL clone

SCOPe Domain Sequences for d5ifhl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ifhl2 b.1.1.2 (L:111-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5ifhl2:

Click to download the PDB-style file with coordinates for d5ifhl2.
(The format of our PDB-style files is described here.)

Timeline for d5ifhl2:

  • d5ifhl2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5ifhl1
View in 3D
Domains from other chains:
(mouse over for more information)
d5ifhh1