SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5imbb_ (5imb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126575Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2126589Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2126590Protein automated matches [193326] (9 species)
    not a true protein
  7. 2268561Species Vibrio cholerae [TaxId:243277] [311867] (7 PDB entries)
  8. 2287421Domain d5imbb_: 5imb B: [330722]
    automated match to d4y2zb_
    mutant

Details for d5imbb_

PDB Entry: 5imb (more details), 2.4 Å

PDB Description: crystal structure of peptidyl-trna hydrolase mutant-n14d from vibrio cholerae
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5imbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5imbb_ c.56.3.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
sqpikllvgladpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsqel
rvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghnglkd
tisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqecldaavdesvrcleilmkd
gltkaqnrlhtfkae

SCOPe Domain Coordinates for d5imbb_:

Click to download the PDB-style file with coordinates for d5imbb_.
(The format of our PDB-style files is described here.)

Timeline for d5imbb_:

  • d5imbb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from other chains:
(mouse over for more information)
d5imba_