Lineage for d5b3mo_ (5b3m O:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422468Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2422469Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 2422470Family b.76.1.1: Outer surface protein [51088] (3 proteins)
  6. 2422482Protein automated matches [190440] (3 species)
    not a true protein
  7. 2422500Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (25 PDB entries)
  8. 2422525Domain d5b3mo_: 5b3m O: [330720]
    automated match to d3aumo_
    mutant

Details for d5b3mo_

PDB Entry: 5b3m (more details), 1.9 Å

PDB Description: a mutant of ospa
PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d5b3mo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3mo_ b.76.1.1 (O:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
ltisddlgqttlevfksdgstlvskkvtskdkvlgdvkfnekgevsekiitradgtrley
tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtdss
aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde
iknalk

SCOPe Domain Coordinates for d5b3mo_:

Click to download the PDB-style file with coordinates for d5b3mo_.
(The format of our PDB-style files is described here.)

Timeline for d5b3mo_: