SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ilda1 (5ild A:13-220)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004426Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2004750Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2004751Protein automated matches [226931] (9 species)
    not a true protein
  7. 2004776Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225865] (22 PDB entries)
  8. 2287401Domain d5ilda1: 5ild A:13-220 [330702]
    Other proteins in same PDB: d5ilda2
    automated match to d3lz9a1
    complexed with mes, mg

Details for d5ilda1

PDB Entry: 5ild (more details), 2.12 Å

PDB Description: tobacco 5-epi-aristolochene synthase with mes buffer molecule and mg2+ ions
PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d5ilda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ilda1 a.102.4.0 (A:13-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ivrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlid
tierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqde
ngkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvth
aleqclhkgvprvetrffissiydkeqs

SCOPe Domain Coordinates for d5ilda1:

Click to download the PDB-style file with coordinates for d5ilda1.
(The format of our PDB-style files is described here.)

Timeline for d5ilda1:

  • d5ilda1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5ilda2