SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ikeb_ (5ike B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126575Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2126589Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2126590Protein automated matches [193326] (9 species)
    not a true protein
  7. 2268561Species Vibrio cholerae [TaxId:243277] [311867] (7 PDB entries)
  8. 2287394Domain d5ikeb_: 5ike B: [330695]
    automated match to d4y2zb_
    mutant

Details for d5ikeb_

PDB Entry: 5ike (more details), 2.09 Å

PDB Description: crystal structure of mutant-d97n of peptidyl-trna hydrolase from vibrio cholerae
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d5ikeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ikeb_ c.56.3.0 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
vsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsqe
lrvlipttfmnlsgkaiaalanfyqikpeeimvahneldlppgvakfkqggghgghnglk
dtisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrcleilmk
dgltkaqnrlhtfkae

SCOPe Domain Coordinates for d5ikeb_:

Click to download the PDB-style file with coordinates for d5ikeb_.
(The format of our PDB-style files is described here.)

Timeline for d5ikeb_:

  • d5ikeb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from other chains:
(mouse over for more information)
d5ikea_