Lineage for d5l2og_ (5l2o G:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2481728Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2482050Protein automated matches [190401] (5 species)
    not a true protein
  7. 2482051Species Human (Homo sapiens) [TaxId:9606] [189906] (22 PDB entries)
  8. 2482085Domain d5l2og_: 5l2o G: [330690]
    automated match to d5ac2a_
    complexed with 6zw, cl, yb

Details for d5l2og_

PDB Entry: 5l2o (more details), 2.05 Å

PDB Description: crystal structure of aldh1a1 in complex with buc22
PDB Compounds: (G:) Retinal dehydrogenase 1

SCOPe Domain Sequences for d5l2og_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l2og_ c.82.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlpvlltdlkiqytkifinnewhdsvsgkkfpvfnpateeelcqveegdkedvdkavkaa
rqafqigspwrtmdasergrllykladlierdrlllatmesmnggklysnaylndlagci
ktlrycagwadkiqgrtipidgnfftytrhepigvcgqiipwnfplvmliwkigpalscg
ntvvvkpaeqtpltalhvaslikeagfppgvvnivpgygptagaaisshmdidkvaftgs
tevgklikeaagksnlkrvtlelggkspcivladadldnavefahhgvfyhqgqcciaas
rifveesiydefvrrsverakkyilgnpltpgvtqgpqidkeqydkildliesgkkegak
lecgggpwgnkgyfvqptvfsnvtdemriakeeifgpvqqimkfkslddvikranntfyg
lsagvftkdidkaitissalqagtvwvncygvvsaqcpfggfkmsgngrelgeygfheyt
evktvtvkisqkns

SCOPe Domain Coordinates for d5l2og_:

Click to download the PDB-style file with coordinates for d5l2og_.
(The format of our PDB-style files is described here.)

Timeline for d5l2og_: