Lineage for d5j5he1 (5j5h E:1-205)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073887Protein automated matches [190922] (2 species)
    not a true protein
  7. 2073888Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (30 PDB entries)
  8. 2287386Domain d5j5he1: 5j5h E:1-205 [330687]
    Other proteins in same PDB: d5j5ha2, d5j5hb2, d5j5hc2, d5j5hd2, d5j5he2, d5j5hh2, d5j5hi2, d5j5hj2
    automated match to d3u8kd_
    complexed with 6gk, nag, po4

Details for d5j5he1

PDB Entry: 5j5h (more details), 2.7 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with 6-(2-methoxyphenyl)-n4,n4-bis[(pyridin-2-yl)methyl]pyrimidine-2, 4-diamine
PDB Compounds: (E:) acetylcholine-binding protein

SCOPe Domain Sequences for d5j5he1:

Sequence, based on SEQRES records: (download)

>d5j5he1 b.96.1.1 (E:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d5j5he1 b.96.1.1 (E:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d5j5he1:

Click to download the PDB-style file with coordinates for d5j5he1.
(The format of our PDB-style files is described here.)

Timeline for d5j5he1:

  • d5j5he1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08