SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ggzd_ (5ggz D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190933Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2190934Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2190935Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 protein domains)
  6. 2191125Protein automated matches [190229] (10 species)
    not a true protein
  7. 2191138Species Human (Homo sapiens) [TaxId:9606] [187292] (120 PDB entries)
  8. 2287385Domain d5ggzd_: 5ggz D: [330686]
    automated match to d2xjxa_
    complexed with 6tn

Details for d5ggzd_

PDB Entry: 5ggz (more details), 2.02 Å

PDB Description: crystal structure of novel inhibitor bound with hsp90
PDB Compounds: (D:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5ggzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ggzd_ d.122.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagvdismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvekk

SCOPe Domain Coordinates for d5ggzd_:

Click to download the PDB-style file with coordinates for d5ggzd_.
(The format of our PDB-style files is described here.)

Timeline for d5ggzd_:

  • d5ggzd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08