Lineage for d5jrdt_ (5jrd T:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222239Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2222240Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2222380Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2222381Protein automated matches [191172] (7 species)
    not a true protein
  7. 2287382Species Escherichia coli [TaxId:199310] [330683] (3 PDB entries)
  8. 2287384Domain d5jrdt_: 5jrd T: [330685]
    Other proteins in same PDB: d5jrdl_, d5jrdm_
    automated match to d3rgws_
    complexed with cl, f3s, fco, mg, ni, sf3, sf4, so4

Details for d5jrdt_

PDB Entry: 5jrd (more details), 1.2 Å

PDB Description: e. coli hydrogenase-1 variant p508a
PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d5jrdt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrdt_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 199310]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrv

SCOPe Domain Coordinates for d5jrdt_:

Click to download the PDB-style file with coordinates for d5jrdt_.
(The format of our PDB-style files is described here.)

Timeline for d5jrdt_:

  • d5jrdt_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08