SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jrds_ (5jrd S:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222239Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2222240Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2222380Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2222381Protein automated matches [191172] (7 species)
    not a true protein
  7. 2287382Species Escherichia coli [TaxId:199310] [330683] (1 PDB entry)
  8. 2287383Domain d5jrds_: 5jrd S: [330684]
    Other proteins in same PDB: d5jrdl_, d5jrdm_
    automated match to d3rgws_
    complexed with cl, f3s, fco, mg, ni, sf3, sf4, so4

Details for d5jrds_

PDB Entry: 5jrd (more details), 1.2 Å

PDB Description: e. coli hydrogenase-1 variant p508a
PDB Compounds: (S:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d5jrds_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrds_ e.19.1.0 (S:) automated matches {Escherichia coli [TaxId: 199310]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrv

SCOPe Domain Coordinates for d5jrds_:

Click to download the PDB-style file with coordinates for d5jrds_.
(The format of our PDB-style files is described here.)

Timeline for d5jrds_:

  • d5jrds_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08