SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jvea_ (5jve A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987554Family a.24.3.2: Cytochrome c'-like [47179] (3 protein domains)
    automatically mapped to Pfam PF01322
  6. 1987599Protein automated matches [190363] (5 species)
    not a true protein
  7. 2287374Species Alcaligenes xylosoxydans [TaxId:85698] [330675] (7 PDB entries)
  8. 2287375Domain d5jvea_: 5jve A: [330676]
    automated match to d4cdaa_
    complexed with hec; mutant

Details for d5jvea_

PDB Entry: 5jve (more details), 1.12 Å

PDB Description: l16i mutant of cytochrome c prime from alcaligenes xylosoxidans: ferrous state
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d5jvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jvea_ a.24.3.2 (A:) automated matches {Alcaligenes xylosoxydans [TaxId: 85698]}
efakpedavkyrqsaitlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrk

SCOPe Domain Coordinates for d5jvea_:

Click to download the PDB-style file with coordinates for d5jvea_.
(The format of our PDB-style files is described here.)

Timeline for d5jvea_:

  • d5jvea_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08