SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ickb_ (5ick B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008559Protein Bile acid receptor FXR [101433] (2 species)
  7. 2008560Species Human (Homo sapiens) [TaxId:9606] [101434] (8 PDB entries)
  8. 2287371Domain d5ickb_: 5ick B: [330672]
    automated match to d3ruua_
    complexed with fez

Details for d5ickb_

PDB Entry: 5ick (more details), 2.47 Å

PDB Description: a unique binding model of fxr lbd with feroline
PDB Compounds: (B:) Bile acid receptor

SCOPe Domain Sequences for d5ickb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ickb_ a.123.1.1 (B:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

SCOPe Domain Coordinates for d5ickb_:

Click to download the PDB-style file with coordinates for d5ickb_.
(The format of our PDB-style files is described here.)

Timeline for d5ickb_:

  • d5ickb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08